PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G172400.2
Common NameB456_008G172400, LOC105764416
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 133aa    MW: 15141.4 Da    PI: 6.6213
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G172400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.35.4e-1177118144
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                         ++ ++++E+ l+++ +++ G + W++Ia +++ gRt+++++ +w
  Gorai.008G172400.2  77 KLDFSEDEETLIIRMFNLVGER-WSLIAGRIP-GRTAEEIQKYW 118
                         5789******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.30672122IPR017877Myb-like domain
SMARTSM007175.3E-876124IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-979122IPR009057Homeodomain-like
PfamPF002498.4E-1079118IPR001005SANT/Myb domain
CDDcd001671.03E-980118No hitNo description
Gene3DG3DSA:1.10.10.607.4E-1380120IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MQTPTVPTDK YRNSTTYQRP PLSTTTILPP LNQPCRLLLL LQFPRLKQQL LCLKLLFMAD  60
MDGSSVDSKE ESTGDSKLDF SEDEETLIIR MFNLVGERWS LIAGRIPGRT AEEIQKYWAS  120
RFSYNNPMPN PS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438425.17e-94PREDICTED: uncharacterized protein LOC105764416
TrEMBLA0A0D2U1A27e-94A0A0D2U1A2_G
STRINGVIT_12s0059g02360.t011e-31(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.16e-17MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]